Spring Into Savings With Our March/April Promotions! VIEW NOW > 
Home Searchdeva curl
Can't find a Product?

deva curl

(393 Items)
  • 97711 DEV-10-TWIST DEV-10-TWIST 1 DevaTwist DevaCurl DevaCurl DevaTwist False devacurl/devacurldevatwisttowel.jpg Bonus Deal Available 15.50 15.50 15.50 False False False False 0.00 False False Diversion contract is required Share the hands-free, frizz-fighting, multitasking way to dry curls with your clients with the DevaTwist. True Log in to view pricing! False
    DevaCurl DevaTwist

    DevaCurl
    DevaTwist

    SKU DEV-10-TWIST
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 142279 DEV-03-MOW10 DEV-03-MOW10 1 MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. DevaCurl DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz. True devacurl/devacurlmistofwondersleavein10oz.jpg Bonus Deal Available 20.00 20.00 20.00 False False False False 0.00 False False Diversion contract is required DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray is an instant multi-benefit curl spray that moisturizes and reduces frizz by up to 85%. True Log in to view pricing! False
    DevaCurl MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray 10 Fl. Oz.

    DevaCurl
    MIST OF WONDERS LEAVE-IN Instant Multi-Benefit Curl Spray
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109748 DEV-12-SCR3 DEV-12-SCR3 1 SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. DevaCurl DevaCurl SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagssupercream3oz.jpg Bonus Deal Available 9.00 9.00 9.00 False False False False 0.00 False False Diversion contract is required DevaCurl SUPERCREAM Rich Coconut-Infused Definer is a multitasking, ultra-rich cream with a hydra-definition blend that provides coarse curls with smoothness, shape, shine, and frizz control. True Log in to view pricing! False
    DevaCurl SUPERCREAM Rich Coconut-Infused Definer 3 Fl. Oz.

    DevaCurl
    SUPERCREAM Rich Coconut-Infused Definer
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109769 DEV-12-WM3 DEV-12-WM3 1 WAVE MAKER Lightweight Moisturizing Definer 3 Fl. Oz. DevaCurl DevaCurl WAVE MAKER Lightweight Moisturizing Definer 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagswavemaker3oz.jpg Bonus Deal Available 9.00 9.00 9.00 False False False False 0.00 False False Diversion contract is required DevaCurl WAVE MAKER Lightweight Moisturizing Definer is a lightweight cream with a hydra-definition blend that provides fine curls with shape and frizz control. True Log in to view pricing! False
    DevaCurl WAVE MAKER Lightweight Moisturizing Definer 3 Fl. Oz.

    DevaCurl
    WAVE MAKER Lightweight Moisturizing Definer
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109742 DEV-12-PP16 DEV-12-PP16 1 PLUMPING PRIMER Body-Building GelĂ©e 16 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building GelĂ©e 16 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer16oz.jpg Bonus Deal Available 25.00 25.00 25.00 False False False False 0.00 False False Diversion contract is required DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. False Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 16 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109769 DEV-12-WM5 DEV-12-WM5 1 WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. DevaCurl DevaCurl WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagswavemaker5oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required DevaCurl WAVE MAKER Lightweight Moisturizing Definer is a lightweight cream with a hydra-definition blend that provides fine curls with shape and frizz control. True Log in to view pricing! False
    DevaCurl WAVE MAKER Lightweight Moisturizing Definer 5 Fl. Oz.

    DevaCurl
    WAVE MAKER Lightweight Moisturizing Definer
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109764 DEV-12-SM5 DEV-12-SM5 1 SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. DevaCurl DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz. False devacurl/devacurlnewpackagingdevagssupermousse5oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer gives curls day 3 volume on day 1 with enhanced bounce, shine, and a soft, no-crunch finish. Humidity-resistant formula reduces frizz and flyaways as well. False Log in to view pricing! False
    DevaCurl SUPERMOUSSE Coconut Oil Infused Volumizer 5 Fl. Oz.

    DevaCurl
    SUPERMOUSSE Coconut Oil Infused Volumizer

    5 Fl. Oz.

    SKU DEV-12-SM5
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 21928 DEV-10-DTOW DEV-10-DTOW 1 DevaTowel 20 inch x 39 inch DevaCurl DevaCurl DevaTowel 20 inch x 39 inch False devacurl/devacurl_devatowel_group_b.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required DevaCurl DevaTowel is a smooth, microfiber texture towel that helps absorb excess moisture and enhances curl shape without roughing them up so your curls dry with more definition and less frizz. True Log in to view pricing! False
    DevaCurl DevaTowel 20 inch x 39 inch

    DevaCurl
    DevaTowel

    20 inch x 39 inch

    SKU DEV-10-DTOW
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109473 DEV-02-CB3 DEV-02-CB3 1 CURLBOND Re-Coiling Mild Lather Cleanser 3 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 3 Fl. Oz. True devacurl/devagscurlbondcleanser3oz.jpg Bonus Deal Available 7.50 7.50 7.50 False False False False 0.00 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 3 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 122877 DEV-12-UDG12F DEV-12-UDG12F 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False
    DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz.

    DevaCurl
    Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

    12 Fl. Oz.

    SKU DEV-12-UDG12F
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109473 DEV-02-CB32 DEV-02-CB32 1 CURLBOND Re-Coiling Mild Lather Cleanser Liter DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser Liter True devacurl/devagscurlbondcleanser32oz.jpg Bonus Deal Available 31.00 31.00 31.00 False False False False 0.00 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser Liter

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109589 DEV-03-CBM17 DEV-03-CBM17 1 CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz. True devacurl/devagscurlbondmask1775oz.jpg Bonus Deal Available 39.00 39.00 39.00 False False False False 0.00 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 17.75 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Treatment Mask
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 122879 DEV-12-SCR5F DEV-12-SCR5F 1 Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicsupercream51floz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM's hydra-definition blend provides coarse curls with smoothness, shape, shine and frizz control. False Log in to view pricing! False
    DevaCurl Fragrance-Free & Hypoallergenic SUPERCREAM 5.1 Fl. Oz.

    DevaCurl
    Fragrance-Free & Hypoallergenic SUPERCREAM

    5.1 Fl. Oz.

    SKU DEV-12-SCR5F
    Bonus Offer
    Log in to view pricing!
    Quick View
  • 109733 DEV-12-LDG3 DEV-12-LDG3 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel3oz.jpg Bonus Deal Available 7.00 7.00 7.00 False False False False 0.00 False False Diversion contract is required DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler
    Bonus Offer
    Log in to view pricing!
    View Sizes
  • 109614 DEV-03-HIH8 DEV-03-HIH8 1 HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. DevaCurl DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz. False devacurl/devacurlheaveninhair8oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl HEAVEN IN HAIR Moisturizing Deep Conditioner 8 Fl. Oz.

    DevaCurl
    HEAVEN IN HAIR Moisturizing Deep Conditioner

    8 Fl. Oz.

    SKU DEV-03-HIH8
    Bonus Offer
    Log in to view pricing!
    Quick View
(393 Items)