styling

Jan/Feb Promos Are Now Available!

(433 Items)

52717 TRS-12-HAPR8 TRS-12-HAPR8 1 Hair Protector 8.45 Fl. Oz. Truss Truss Hair Protector 8.45 Fl. Oz. False truss/trusshairprotector8.45.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required 0 Truss Hair Protector is a lightweight gel/cream-based daily leave-in that restores hair's natural structure, detangles, and offers thermal protection from the blow dryer and flat iron. True Log in to view pricing! False

Truss
Hair Protector

8.45 Fl. Oz.

SKU TRS-12-HAPR8

Log in to view pricing!
Quick View
143405 CUL-12-LOG12 CUL-12-LOG12 1 The Light One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Light One Styling Gel 12 Fl. Oz. True curlisto/curlistothelightone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Light One Styling Gel is a lightweight, light hold gel for all hair types. True Log in to view pricing! False

Curlisto
The Light One Styling Gel

Promotional ItemLog in to view pricing!
View Sizes
143408 CUL-12-SOG12 CUL-12-SOG12 1 The Strong One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Strong One Styling Gel 12 Fl. Oz. True curlisto/curlistostrongone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Strong One Styling gel is the ultimate definition of curls your way all day. True Log in to view pricing! False

Curlisto
The Strong One Styling Gel

Promotional ItemLog in to view pricing!
View Sizes
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False

DevaCurl
PLUMPING PRIMER Body-Building Gelée

Promotional ItemLog in to view pricing!
View Sizes
109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. False Log in to view pricing! False

DevaCurl
ULTRA DEFINING GEL Strong Hold No-Crunch Styler

Promotional ItemLog in to view pricing!
View Sizes
70749 LOM-03-DC8 LOM-03-DC8 1 Deep Conditioner 8 Fl. Oz. LOMA LOMA Deep Conditioner 8 Fl. Oz. True loma/lomadeepcond8oz.jpg Bonus Deal Available 12.00 12.00 8.40 True True Valid Thru 02/28/25 False False 8.40 False True Diversion contract is required 0 LOMA Deep Conditioner is a triple use product that can be used as an intensive deep conditioner, luxurious cleansing conditioner, and a texturizing styler! True Log in to view pricing! False

LOMA
Deep Conditioner

Promotional ItemLog in to view pricing!
View Sizes
157840 SUR-03-TPC4 SUR-03-TPC4 1 PROTEIN CREAM 4 Fl. Oz. Surface Hair Surface Hair TRINITY COLOR CARE PROTEIN CREAM 4 Fl. Oz. True surfacehair/surfacetrinitycolorcareproteincream4floz.jpg Bonus Deal Available 18.19 18.19 18.19 False False False False 0.00 False False Diversion contract is required 0 Surface Hair TRINITY COLOR CARE PROTEIN CREAM penetrates the hair to protect color. True Log in to view pricing! False

Surface Hair
TRINITY COLOR CARE PROTEIN CREAM

Promotional ItemLog in to view pricing!
View Sizes
164660 CRU-25-JFRT CRU-25-JFRT 1 Carmen Rituel Try Me Kit 14 pc. Eugene Perma Professional Eugene Perma Professional Carmen Rituel Try Me Kit 14 pc. False eugenepermaprofessional/eugenepermacarmenritueltrymekit14pc.jpg Bonus Deal Available 89.50 89.50 89.50 False True Valid Thru 02/28/25 False False 0.00 True False Diversion contract is required 0 Eugene Perma Professional Carmen Rituel Try Me Kit includes color, activator, jelly, balm, and chart. True Log in to view pricing! False

Eugene Perma Professional
Carmen Rituel Try Me Kit

Promotional ItemLog in to view pricing!
View Details
166165 KRT-25-STY25 KRT-25-STY25 1 Buy 2 Argan Oil, Get 20.25% OFF! 2 pc. Keratherapy Keratherapy Buy 2 Argan Oil, Get 20.25% OFF! 2 pc. False keratherapy/keratherapybuy2arganoilget-20.25percentoff.jpg Bonus Deal Available 25.12 25.12 25.12 False True Valid Thru 02/28/25 False False 0.00 False False Diversion contract is required 0 Keratherapy Buy 2 Argan Oil, Get 20.25% OFF!
Includes:
2 Argan Oil 1.7 oz. True Log in to view pricing! False

Keratherapy
Buy 2 Argan Oil, Get 20.25% OFF!

2 pc.

SKU KRT-25-STY25

Promotional ItemLog in to view pricing!
Quick View
166167 KRT-25-FTC25 KRT-25-FTC25 1 Buy Volume SHAMPOO & CONDITIONER, Get ROOT BOOST & VOLUMIZER FREE! 3 pc. Keratherapy Keratherapy Buy Volume SHAMPOO & CONDITIONER, Get ROOT BOOST & VOLUMIZER FREE! 3 pc. False keratherapy/keratherapybuyvolumeshampooandconditionergetrootboostandvolumizerfree.jpg Bonus Deal Available 28.00 28.00 28.00 False True Valid Thru 02/28/25 False False 0.00 False False Diversion contract is required 0 Keratherapy Buy Volume SHAMPOO & CONDITIONER, Get ROOT BOOST & VOLUMIZER FREE!
Purchase:
1 Volume SHAMPOO 10.1 oz.
1 Volume CONDITIONER 10.1 oz.
Receive FREE:
1 ROOT BOOST & VOLUMIZER 8.5 oz. True Log in to view pricing! False

Keratherapy
Buy Volume SHAMPOO & CONDITIONER, Get ROOT BOOST & VOLUMIZER FREE!

3 pc.

SKU KRT-25-FTC25

Promotional ItemLog in to view pricing!
Quick View
165010 SUR-25-JFAMM SUR-25-JFAMM 1 AWAKEN 2 for $32 2 pc. Surface Hair Surface Hair AWAKEN 2 for $32 2 pc. False surfacehair/jf25surface2for32.jpg Bonus Deal Available 32.00 32.00 32.00 False True Valid Thru 02/28/25 False False 0.00 True False Diversion contract is required 0 Surface Hair AWAKEN 2 for $32 lets you choose your products.
Includes:
2 AWAKEN Items (Your Choice) True Log in to view pricing! False

Surface Hair
AWAKEN 2 for $32

Promotional ItemLog in to view pricing!
View Details
165031 SUR-21-25AWI SUR-21-25AWI 1 AWAKEN Intro 48 pc. Surface Hair Surface Hair AWAKEN Intro 48 pc. False surfacehair/surfaceintro.jpg Bonus Deal Available 560.96 560.96 560.96 False True Valid Thru 02/28/25 False False 0.00 False False Diversion contract is required 0 Surface Hair AWAKEN Intro includes shampoo, conditioner, treatment, mist, mousse, spray, cream, foam, mask, pumps, and merch kit. True Log in to view pricing! False

Surface Hair
AWAKEN Intro

48 pc.

SKU SUR-21-25AWI

Promotional ItemLog in to view pricing!
Quick View
165011 SUR-25-JFSB SUR-25-JFSB 1 Buy 6 AWAKEN Items, Get SCALP MASSAGE BRUSH FREE! 7 pc. Surface Hair Surface Hair Buy 6 AWAKEN Items, Get SCALP MASSAGE BRUSH FREE! 7 pc. False surfacehair/jf25surfaceawakendeal.jpg Bonus Deal Available 0.00 0.00 0.00 False True Valid Thru 02/28/25 False False 0.00 True False Diversion contract is required 0 Surface Hair Buy 6 AWAKEN Items, Get SCALP MASSAGE BRUSH FREE!
Purchase:
6 AWAKEN Items (Your Choice)
Receive FREE:
1 SCALP MASSAGE BRUSH True Log in to view pricing! False

Surface Hair
Buy 6 AWAKEN Items, Get SCALP MASSAGE BRUSH FREE!

Promotional ItemLog in to view pricing!
View Details
164658 TRS-25-JFPR TRS-25-JFPR 1 Pro & Retail Treatment Promo 8 pc. Truss Truss Pro & Retail Treatment Promo 8 pc. False truss/trussproandretailpromo8pc.jpg Bonus Deal Available 183.00 183.00 183.00 False True Valid Thru 02/28/25 False False 0.00 False False Diversion contract is required 0 Truss Pro & Retail Treatment Promo includes professional and retail products to repair and protect hair, featuring shampoos, treatments, and masks. True Log in to view pricing! False

Truss
Pro & Retail Treatment Promo

8 pc.

SKU TRS-25-JFPR

Promotional ItemLog in to view pricing!
Quick View