styling gel

Holiday Promotions Are Now Available! >

Cozy Up with Our November & December Winter Deals!

(37 Items)

63211 ABA-12-STGE6 ABA-12-STGE6 1 Style Gel Medium Hold 6 Fl. Oz. ABBA® ABBA® pure style Style Gel Medium Hold 6 Fl. Oz. False abba/abbanewstylegelmediumhold6oz177ml.jpg Bonus Deal Available 11.50 11.50 8.63 True True Valid Thru 12/31/24 False False 8.63 False False Diversion contract is required 0 ABBA pure style Style Gel Medium Hold creates shape, texture and a medium hold for all hair types. True Log in to view pricing! False

ABBA®
pure style Style Gel Medium Hold

6 Fl. Oz.

SKU ABA-12-STGE6

Promotional ItemLog in to view pricing!
Quick View
85265 KCX-12-SHGE5 KCX-12-SHGE5 1 Strong Hold Gel 5 Fl. Oz. Keratin Complex Keratin Complex Strong Hold Gel 5 Fl. Oz. False keratincomplex/so19keratincomplexstronggel5oz.jpg Bonus Deal Available 12.00 12.00 9.96 True True Valid Thru 12/31/24 False False 9.96 False False Diversion contract is required 0 Keratin Complex's Strong Hold Gel defines or molds every style with a firm, all-day hold. Perfect for wet or dry looks. True Log in to view pricing! False

Keratin Complex
Strong Hold Gel

5 Fl. Oz.

SKU KCX-12-SHGE5

Promotional ItemLog in to view pricing!
Quick View
85264 KCX-12-STGEL8 KCX-12-STGEL8 1 Styling Gel 8 Fl. Oz. Keratin Complex Keratin Complex Styling Gel 8 Fl. Oz. False keratincomplex/so19keratincomplexstylinggel8oz.jpg Bonus Deal Available 12.00 12.00 9.96 True True Valid Thru 12/31/24 False False 9.96 False False Diversion contract is required 0 Keratin Complex's Styling Gel has a lightweight, conditioning formula providing long-lasting control. Perfect for curl definition and shine! True Log in to view pricing! False

Keratin Complex
Styling Gel

8 Fl. Oz.

SKU KCX-12-STGEL8

Promotional ItemLog in to view pricing!
Quick View
159687 OLX-12-NO106 OLX-12-NO106 1 Nº.10 BOND SHAPER CURL DEFINING GEL 6.7 Fl. Oz. OLAPLEX OLAPLEX Nº.10 BOND SHAPER CURL DEFINING GEL 6.7 Fl. Oz. False olaplex/olaplexno10bondshapercurldefininggel.jpg Bonus Deal Available 15.00 15.00 12.00 True True Valid Thru 11/22/24 False False 12.00 False False Diversion contract is required 0 OLAPLEX Nº.10 BOND SHAPER CURL DEFINING GEL helps revive natural curl patterns in wavy and curly hair. True Log in to view pricing! False

OLAPLEX
Nº.10 BOND SHAPER CURL DEFINING GEL

6.7 Fl. Oz.

SKU OLX-12-NO106

Promotional ItemLog in to view pricing!
Quick View
33462 WEL-12-EPS3 WEL-12-EPS3 1 Dry Pearl Styler Styling Gel 3.5 Fl. Oz. Wella Wella Professionals EIMI Dry Pearl Styler Styling Gel 3.5 Fl. Oz. False wella/wellapropearlstyler.jpg Bonus Deal Available 13.00 13.00 10.40 True False False False 10.40 False False Diversion contract is required 0 Wella Professionals EIMI Dry Pearl Styler Styling Gel creates strong, flexible hold and teasable texture with pearl gloss shine. True Log in to view pricing! False

Wella
Professionals EIMI Dry Pearl Styler Styling Gel

3.5 Fl. Oz.

SKU WEL-12-EPS3

On SaleLog in to view pricing!
Quick View
125657 WEL-12-ESF4 WEL-12-ESF4 1 Sculpt Force Styling Hair Gel 4.58 Fl. Oz. Wella Wella Professionals EIMI Sculpt Force Styling Hair Gel 4.58 Fl. Oz. False wella/wellaprofessionaleimisculptforce4oz.jpg Bonus Deal Available 12.05 12.05 9.64 True False False False 9.64 False False Diversion contract is required 0 Wella Professionals Sculpt Force Styling Hair Gel allows you to get creative with expressive shaping on rock solid styles. True Log in to view pricing! False

Wella
Professionals EIMI Sculpt Force Styling Hair Gel

4.58 Fl. Oz.

SKU WEL-12-ESF4

On SaleLog in to view pricing!
Quick View
42468 WEL-12-ESM5 WEL-12-ESM5 1 Shape Me Gel 5.43 Fl. Oz. Wella Wella Professionals EIMI Shape Me Gel 5.43 Fl. Oz. False wella/wellaeimishapemegel.jpg Bonus Deal Available 13.00 13.00 10.40 True False False False 10.40 False False Diversion contract is required 0 Wella Professionals EIMI Shape Me Gel is a heat-activated hair gel formulated with memorizing polymer complex that helps to shape or blow-dry hair the way you want and keep the look up to 48 hours. True Log in to view pricing! False

Wella
Professionals EIMI Shape Me Gel

5.43 Fl. Oz.

SKU WEL-12-ESM5

On SaleLog in to view pricing!
Quick View
55477 STS-12-FZG5 STS-12-FZG5 1 Frozen Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Frozen Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparffrozengel53floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Frozen Gel is a gel for extreme ice-effect looks. Crystallizes and sets the hair style. A perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Frozen Gel

5.3 Fl. Oz.

SKU STS-12-FZG5

Log in to view pricing!
Quick View
55471 STS-12-TG5 STS-12-TG5 1 Texturizing Gel 5.07 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Texturizing Gel 5.07 Fl. Oz. False alfaparfmilano/mj18alfaparftexturizinggel507floz.jpg Bonus Deal Available 12.00 12.00 12.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Texturizing Gel brings structure to the hair fiber, for defined and malleable results with a natural effect. Suitable for all hair types, even to enhance natural drying. True Log in to view pricing! False

Alfaparf Milano
Style Stories Texturizing Gel

5.07 Fl. Oz.

SKU STS-12-TG5

Log in to view pricing!
Quick View
55475 STS-12-WG5 STS-12-WG5 1 Wet Gel 5.3 Fl. Oz. Alfaparf Milano Alfaparf Milano Style Stories Wet Gel 5.3 Fl. Oz. False alfaparfmilano/mj18alfaparfwetgel53floz.jpg Bonus Deal Available 13.00 13.00 13.00 False False False False 0.00 False False Diversion contract is required 0 Alfaparf Milano Style Stories Wet Gel is a gel with a wet effect, for flexible and residue-free results. Perfect look for 8 hours! True Log in to view pricing! False

Alfaparf Milano
Style Stories Wet Gel

5.3 Fl. Oz.

SKU STS-12-WG5

Log in to view pricing!
Quick View
143405 CUL-12-LOG12 CUL-12-LOG12 1 The Light One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Light One Styling Gel 12 Fl. Oz. True curlisto/curlistothelightone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Light One Styling Gel is a lightweight, light hold gel for all hair types. True Log in to view pricing! False

Curlisto
The Light One Styling Gel

Log in to view pricing!
View Sizes
143407 CUL-12-POSG8 CUL-12-POSG8 1 The Perfect One Spray Gel 8 Fl. Oz. Curlisto Curlisto The Perfect One Spray Gel 8 Fl. Oz. False curlisto/curlistotheperfectone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 The Perfect One Spray Gel is a fast-setting, medium-hold gel for all hair types. True Log in to view pricing! False

Curlisto
The Perfect One Spray Gel

8 Fl. Oz.

SKU CUL-12-POSG8

Log in to view pricing!
Quick View
143408 CUL-12-SOG12 CUL-12-SOG12 1 The Strong One Styling Gel 12 Fl. Oz. Curlisto Curlisto The Strong One Styling Gel 12 Fl. Oz. True curlisto/curlistostrongone.jpg Bonus Deal Available 14.50 14.50 14.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Strong One Styling gel is the ultimate definition of curls your way all day. True Log in to view pricing! False

Curlisto
The Strong One Styling Gel

Log in to view pricing!
View Sizes
122877 DEV-12-UDG12F DEV-12-UDG12F 1 Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. DevaCurl DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL 12 Fl. Oz. False devacurl/devacurlfragrancefreehypoallergenicultradefininggel12floz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL's curl-locking blend provides strong hold and non-sticky curl cast that defines, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
Fragrance-Free & Hypoallergenic ULTRA DEFINING GEL

12 Fl. Oz.

SKU DEV-12-UDG12F

Log in to view pricing!
Quick View
109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

Log in to view pricing!
View Sizes