Jan/Feb Promos Are Now Available! VIEW NOW > 

devacurl

(51 Items)
  • 166115 DEVAJUMBO DEVAJUMBO 1 20% Off Jumbo's Click To View Options DevaCurl DevaCurl 20% Off Jumbo's Click To View Options False devacurl/devacurllitergroup.jpg Bonus Deal Available 0.00 0.00 0.00 False True Valid Thru 03/01/25 False False 0.00 True False Diversion contract is required 0 DevaCurl 20% Off Jumbo's. True Log in to view pricing! False
    DevaCurl 20% Off Jumbo's

    DevaCurl
    20% Off Jumbo's

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Details
  • 109582 DEV-03-CBB32 DEV-03-CBB32 1 CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter DevaCurl DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter False devacurl/devacurlcurlbondproboost.jpg Bonus Deal Available 84.00 84.00 67.20 True True Valid Thru 02/28/25 False False 67.20 False False Diversion contract is required 0 DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment tames frizz for up to 50 washes and maintains the integrity of hair after a color service. True Log in to view pricing! False
    DevaCurl CURLBOND PRO BOOST Re-Coiling In-Salon Treatment Liter

    DevaCurl
    CURLBOND PRO BOOST Re-Coiling In-Salon Treatment

    Liter

    SKU DEV-03-CBB32

    Bonus Offer
    Promotional ItemLog in to view pricing!
    Quick View
  • 109579 DEV-03-CB12 DEV-03-CB12 1 CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz. True devacurl/devagscurlbondconditioner12oz(1).jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Cream Conditioner with Patented CurlBond Complex re-coils damaged curls, softens, detangles, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Cream Conditioner 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109473 DEV-02-CB12 DEV-02-CB12 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109589 DEV-03-CBM8 DEV-03-CBM8 1 CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz. True devacurl/devacurlcurlbond8floz.jpg Bonus Deal Available 22.00 22.00 22.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl CURLBOND Re-Coiling Treatment Mask is a rich, reparative mask with Patented CURLBOND Complex re-coils damaged curls, conditions, and works from the inside out to help re-link broken bonds, improve strength, seal split ends and protect from future damage. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Treatment Mask 8 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Treatment Mask

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 152679 DEV-02-CH12 DEV-02-CH12 1 CURLHEIGHTS Volume + Body Boost Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLHEIGHTS Volume + Body Boost Cleanser 12 Fl. Oz. True devacurl/devacurlheightscleanser12oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required 0 Take curls to new heights! DevaCurl CURLHEIGHTS Volume + Body Boost Cleanser with Volume Complex increases volume 2X to roots and reduces frizz by 83% up to 8hrs*, while leaving curls feeling moisturized.

    *When used as a collection.
    True Log in to view pricing! False
    DevaCurl CURLHEIGHTS Volume + Body Boost Cleanser 12 Fl. Oz.

    DevaCurl
    CURLHEIGHTS Volume + Body Boost Cleanser

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 152684 DEV-03-CH12 DEV-03-CH12 1 CURLHEIGHTS Volume + Body Boost Conditioner 12 Fl. Oz. DevaCurl DevaCurl CURLHEIGHTS Volume + Body Boost Conditioner 12 Fl. Oz. True devacurl/devacurlheightsconditioner12oz.jpg Bonus Deal Available 17.00 17.00 17.00 False False False False 0.00 False False Diversion contract is required 0 Take curls to new heights! DevaCurl CURLHEIGHTS Volume + Body Boost Conditioner is a cream conditioner with Volume Complex that increases volume 2X to roots and reduces frizz by 83% up to 8hrs*, while easily detangling, moisturizing, and smoothing.

    *When used as a collection.
    True Log in to view pricing! False
    DevaCurl CURLHEIGHTS Volume + Body Boost Conditioner 12 Fl. Oz.

    DevaCurl
    CURLHEIGHTS Volume + Body Boost Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109733 DEV-12-LDG12 DEV-12-LDG12 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagslightdefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. False Log in to view pricing! False
    DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    LIGHT DEFINING GEL Soft Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109500 DEV-02-LP12 DEV-02-LP12 1 LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagslowpoooriginal12oz(1).jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture is designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl
    LOW-POO ORIGINAL Mild Lather Cleanser For Rich Moisture

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109484 DEV-02-DNP12 DEV-02-DNP12 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoodecadence12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109530 DEV-02-NP12 DEV-02-NP12 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz. True devacurl/devagsnopoooriginal12oz(1).jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False
    DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 12 Fl. Oz.

    DevaCurl
    NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109603 DEV-03-DOC12 DEV-03-DOC12 1 ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsoneconditiondecadence12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner designed for dry, coarse curls. True Log in to view pricing! False
    DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109636 DEV-03-OC12 DEV-03-OC12 1 ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz. True devacurl/devagsoneconditionoriginal12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False
    DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 12 Fl. Oz.

    DevaCurl
    ONE CONDITION ORIGINAL Rich Cream Conditioner

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109742 DEV-12-PP5 DEV-12-PP5 1 PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. DevaCurl DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz. True devacurl/devacurlnewpackagingdevagsplumpingprimer5oz.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required 0 DevaCurl's PLUMPING PRIMER Body-Building Gelée previously B'LEAVE-IN is a lightweight gelée with an Amino Acid Complex for healthy-looking curls primes with a boosting of fullness, moisture, and shine. True Log in to view pricing! False
    DevaCurl PLUMPING PRIMER Body-Building Gelée 5 Fl. Oz.

    DevaCurl
    PLUMPING PRIMER Body-Building Gelée

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 109765 DEV-12-UDG12 DEV-12-UDG12 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz. True devacurl/devacurlnewpackagingdevagsultradefininggel12oz.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. False Log in to view pricing! False
    DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler 12 Fl. Oz.

    DevaCurl
    ULTRA DEFINING GEL Strong Hold No-Crunch Styler

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
(51 Items)