travel/minis hair care

July | August Promotions Are Here!

(116 Items)

109733 DEV-12-LDG3 DEV-12-LDG3 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler 3 Fl. Oz. devacurl/devacurlnewpackagingdevagslightdefininggel3oz.jpg Bonus Deal Available 7.20 7.20 5.40 True True Valid Thru 08/31/24 False False 5.40 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

DevaCurl
LIGHT DEFINING GEL Soft Hold No-Crunch Styler

3 Fl. Oz.

SKU DEV-12-LDG3

Promotional ItemLog in to view pricing!
Quick View
109484 DEV-02-DNP3 DEV-02-DNP3 1 NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 3 Fl. Oz. DevaCurl DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture 3 Fl. Oz. devacurl/devagsnopoodecadence3oz.jpg Bonus Deal Available 7.20 7.20 5.40 True True Valid Thru 08/31/24 False False 5.40 False False Diversion contract is required 0 DevaCurl NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture is designed for dry coarse curls. True Log in to view pricing! False

DevaCurl
NO-POO DECADENCE Zero Lather Cleanser For Ultra-Rich Moisture

3 Fl. Oz.

SKU DEV-02-DNP3

Promotional ItemLog in to view pricing!
Quick View
109530 DEV-02-NP3 DEV-02-NP3 1 NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 3 Fl. Oz. DevaCurl DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture 3 Fl. Oz. devacurl/devagsnopoooriginal3oz.jpg Bonus Deal Available 7.20 7.20 5.40 True True Valid Thru 08/31/24 False False 5.40 False False Diversion contract is required 0 DevaCurl NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture designed for dry, medium to coarse curls. True Log in to view pricing! False

DevaCurl
NO-POO ORIGINAL Zero Lather Cleanser For Rich Moisture

3 Fl. Oz.

SKU DEV-02-NP3

Promotional ItemLog in to view pricing!
Quick View
109603 DEV-03-DOC3 DEV-03-DOC3 1 ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 3 Fl. Oz. DevaCurl DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner 3 Fl. Oz. devacurl/devagsoneconditiondecadence3oz.jpg Bonus Deal Available 7.20 7.20 5.40 True True Valid Thru 08/31/24 False False 5.40 False False Diversion contract is required 0 DevaCurl ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner designed for dry, coarse curls. True Log in to view pricing! False

DevaCurl
ONE CONDITION DECADENCE Ultra-Rich Cream Conditioner

3 Fl. Oz.

SKU DEV-03-DOC3

Promotional ItemLog in to view pricing!
Quick View
109636 DEV-03-OC3 DEV-03-OC3 1 ONE CONDITION ORIGINAL Rich Cream Conditioner 3 Fl. Oz. DevaCurl DevaCurl ONE CONDITION ORIGINAL Rich Cream Conditioner 3 Fl. Oz. devacurl/devagsoneconditionoriginal3oz.jpg Bonus Deal Available 7.20 7.20 5.40 True True Valid Thru 08/31/24 False False 5.40 False False Diversion contract is required 0 DevaCurl ONE CONDITION ORIGINAL Rich Creamy Conditioner is designed for dry, medium to Coarse Curls with olive oil and nourishing botanicals. True Log in to view pricing! False

DevaCurl
ONE CONDITION ORIGINAL Rich Cream Conditioner

3 Fl. Oz.

SKU DEV-03-OC3

Promotional ItemLog in to view pricing!
Quick View
95704 WCM-02-CPS1 WCM-02-CPS1 1 Color Protection Shampoo 1.6 Fl. Oz. Wella Wella Professionals ColorMotion+ Color Protection Shampoo 1.6 Fl. Oz. wella/wellaprofessionalcolormotionplusshampoo1oz.jpg Bonus Deal Available 3.70 3.70 2.96 True False False False 2.96 False False Diversion contract is required 0 Wella ColorMotion+ Color Protection Shampoo helps lock in color while preserving hair’s smoothness and shine. True Log in to view pricing! False

Wella
Professionals ColorMotion+ Color Protection Shampoo

1.6 Fl. Oz.

SKU WCM-02-CPS1

On SaleLog in to view pricing!
Quick View
95706 WCM-03-CRC1 WCM-03-CRC1 1 Color Reflection Conditioner 1 Fl. Oz. Wella Wella Professionals ColorMotion+ Color Reflection Conditioner 1 Fl. Oz. wella/wellacolormotionpluscolorreflectorconditioner1oz.jpg Bonus Deal Available 3.70 3.70 2.96 True False False False 2.96 False False Diversion contract is required 0 Wella ColorMotion+ is a moisturizing Color Reflection Conditioner for frequent use that helps restore hair surface quality for vibrant shine. True Log in to view pricing! False

Wella
Professionals ColorMotion+ Color Reflection Conditioner

1 Fl. Oz.

SKU WCM-03-CRC1

On SaleLog in to view pricing!
Quick View
125580 WEL-02-ER1 WEL-02-ER1 1 Renewing Shampoo 1.01 Fl. Oz. Wella Wella Professionals Elements Renewing Shampoo 1.01 Fl. Oz. wella/wellaelementsrenewingshampoo10z.jpg Bonus Deal Available 3.55 3.55 2.84 True False False False 2.84 False False Diversion contract is required 0 Wella ELEMENTS Renewing Shampoo is a sulfate free shampoo that renews the moisture of the hair, preserving and nourishing it from root to tip. True Log in to view pricing! False

Wella
Professionals Elements Renewing Shampoo

1.01 Fl. Oz.

SKU WEL-02-ER1

On SaleLog in to view pricing!
Quick View
143987 WEL-02-UR3 WEL-02-UR3 1 Step 1 Shampoo 3.3 Fl. Oz. Wella Wella Professionals ULTIMATE REPAIR Step 1 Shampoo 3.3 Fl. Oz. wella/wellaprofessionalultimaterepairshampoo3oz.jpg Bonus Deal Available 9.95 9.95 7.96 True False False False 7.96 False False Diversion contract is required 0 Wella Professionals ULTIMATE REPAIR STEP 1 SHAMPOO is a rich cream shampoo with a lightweight foaming formula that gently and effectively cleanses hair with a luxurious lather. True Log in to view pricing! False

Wella
Professionals ULTIMATE REPAIR Step 1 Shampoo

3.3 Fl. Oz.

SKU WEL-02-UR3

On SaleLog in to view pricing!
Quick View
143994 WEL-03-UR2 WEL-03-UR2 1 Step 2 Conditioner 2.5 Fl. Oz. Wella Wella Professionals ULTIMATE REPAIR Step 2 Conditioner 2.5 Fl. Oz. wella/wellaprofessionalsultimaterepairconditioner2oz.jpg Bonus Deal Available 9.95 9.95 7.96 True False False False 7.96 False False Diversion contract is required 0 Wella Professional ULTIMATE REPAIR STEP 2 CONDITIONER is a deep nourishing conditioner with a rich and creamy texture that doesn't weigh the hair down. True Log in to view pricing! False

Wella
Professionals ULTIMATE REPAIR Step 2 Conditioner

2.5 Fl. Oz.

SKU WEL-03-UR2

On SaleLog in to view pricing!
Quick View
144001 WEL-03-URB1 WEL-03-URB1 1 Step 3 Miracle Hair Rescue 1 Fl. Oz. Wella Wella Professionals ULTIMATE REPAIR Step 3 Miracle Hair Rescue 1 Fl. Oz. wella/wellaprofessionalultimaterepairmiraclehairrepair1oz.jpg Bonus Deal Available 19.30 19.30 15.44 True False False False 15.44 False False Diversion contract is required 0 Wella Professionals ULTIMATE REPAIR STEP 3 MIRACLE HAIR RESCUE is a hair repair treatment that helps reverse hair damage in 90 seconds. True Log in to view pricing! False

Wella
Professionals ULTIMATE REPAIR Step 3 Miracle Hair Rescue

1 Fl. Oz.

SKU WEL-03-URB1

On SaleLog in to view pricing!
Quick View
107970 ABA-03-ALIN1 ABA-03-ALIN1 1 COMPLETE ALL-IN-ONE LEAVE-IN SPRAY 1.7 Fl. Oz. ABBA® ABBA® pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY 1.7 Fl. Oz. abba/abbacompleteallinoneleaveinspray1oz.jpg Bonus Deal Available 5.75 5.75 5.75 False False False False 0.00 False False Diversion contract is required 0 ABBA pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY conditioner improves elasticity, moisturizes, and strengthens hair while reducing breakage. True Log in to view pricing! False

ABBA®
pure specialty COMPLETE ALL-IN-ONE LEAVE-IN SPRAY

1.7 Fl. Oz.

SKU ABA-03-ALIN1

Log in to view pricing!
Quick View
89443 ALX-03-BOS2 ALX-03-BOS2 1 Bombshell Conditioner 2 Fl. Oz. Aloxxi Aloxxi Bombshell Conditioner 2 Fl. Oz. aloxxi/aloxxi_bombshellconditioner2oz.jpg Bonus Deal Available 4.40 4.40 4.40 False False False False 0.00 False False Diversion contract is required 0 Aloxxi Bombshell Conditioner delivers full body and helps reduce dry time. True Log in to view pricing! False

Aloxxi
Bombshell Conditioner

2 Fl. Oz.

SKU ALX-03-BOS2

Log in to view pricing!
Quick View
89445 ALX-02-BOS2 ALX-02-BOS2 1 Bombshell Shampoo 2 Fl. Oz. Aloxxi Aloxxi Bombshell Shampoo 2 Fl. Oz. aloxxi/aloxxi_bombshellshampoo2oz.jpg Bonus Deal Available 4.40 4.40 4.40 False False False False 0.00 False False Diversion contract is required 0 Aloxxi Bombshell Shampoo strengthens hair to restore volume for full body style and helps reduce dry time. True Log in to view pricing! False

Aloxxi
Bombshell Shampoo

2 Fl. Oz.

SKU ALX-02-BOS2

Log in to view pricing!
Quick View
2906 ALX-05-DP1 ALX-05-DP1 1 Dry Shampoo 1.3 Fl. Oz. Aloxxi Aloxxi Dry Shampoo 1.3 Fl. Oz. aloxxi/aloxxidryshampoo13oztravelsize.jpg Bonus Deal Available 5.15 5.15 5.15 False False False False 0.00 False False Diversion contract is required 0 Aloxxi Dry Shampoo absorbs excess oils and refreshes hair with no heavy residue while providing UV protection to help prevent color from fading. True Log in to view pricing! False

Aloxxi
Dry Shampoo

1.3 Fl. Oz.

SKU ALX-05-DP1

Log in to view pricing!
Quick View