liters styling

143405 CUL-25-LOGP CUL-25-LOGP 1 The Light One Styling Gel with Pump Liter Curlisto Curlisto The Light One Styling Gel with Pump Liter curlisto/curlistothelightonebackbarwithpump.jpg Bonus Deal Available 28.50 28.50 28.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Light One Styling Gel is a lightweight, light hold gel for all hair types. True Log in to view pricing! False

143408 CUL-25-SOGP CUL-25-SOGP 1 The Strong One Styling Gel with Pump Liter Curlisto Curlisto The Strong One Styling Gel with Pump Liter curlisto/curlistostrongonebackbarwithpump.jpg Bonus Deal Available 28.50 28.50 28.50 False False False False 0.00 False False Diversion contract is required 0 Curlisto The Strong One Styling gel is the ultimate definition of curls your way all day. True Log in to view pricing! False

109733 DEV-12-LDG32 DEV-12-LDG32 1 LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter DevaCurl DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler Liter devacurl/devacurlnewpackagingdevagslightdefininggel32oz.jpg Bonus Deal Available 29.00 29.00 29.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl LIGHT DEFINING GEL Soft Hold No-Crunch Styler is a non-flaking formula with a curl-locking blend that provides a non-sticky curl cast that enhances shape, fights frizz, and amplifies shine and bounce. True Log in to view pricing! False

109765 DEV-12-UDG32 DEV-12-UDG32 1 ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter DevaCurl DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler Liter devacurl/devacurlnewpackagingdevagsultradefininggel32oz.jpg Bonus Deal Available 29.00 29.00 29.00 False False False False 0.00 False False Diversion contract is required 0 DevaCurl ULTRA DEFINING GEL Strong Hold No-Crunch Styler provides definition without the crunch. True Log in to view pricing! False

70827 LOM-12-CMC33 LOM-12-CMC33 1 Calming Crème Liter LOMA LOMA Calming Crème Liter loma/lomaccliter.jpg Bonus Deal Available 22.00 22.00 22.00 False False False False 0.00 False True Diversion contract is required 0 LOMA Calming Crème quenches thirsty hair, weightlessly detangling, softening, and taming frizz while also adding shine and protecting hair during thermal styling. True Log in to view pricing! False

70958 LOM-03-NOT33 LOM-03-NOT33 1 Nourishing Oil Treatment Liter LOMA LOMA Nourishing Oil Treatment Liter loma/lomanourishingoiltreatmentliter.jpg Bonus Deal Available 103.95 103.95 103.95 False False False False 0.00 False True Diversion contract is required 0 LOMA Nourishing Oil Treatment smooths hair and offers thermal protection. False Log in to view pricing! False

157840 SUR-03-TPC32 SUR-03-TPC32 1 PROTEIN CREAM Liter Surface Hair Surface Hair TRINITY COLOR CARE PROTEIN CREAM Liter surfacehair/surfacetrinitycolorcareproteincreamliter.jpg Bonus Deal Available 83.92 83.92 83.92 False False False False 0.00 False False Diversion contract is required 0 Surface Hair TRINITY COLOR CARE PROTEIN CREAM penetrates the hair to protect color. True Log in to view pricing! False