May/June Magazine Now Available! VIEW NOW>
Discover The Latest May/June Deals!  EXPLORE NOW>

hair care shampoo

(48 Items)
  • 174057 NAK-02-NS12 NAK-02-NS12 1 STRUCTURE COMPLEX PROTEIN SHAMPOO 11.83 Fl. Oz. NAK Hair NAK Hair STRUCTURE COMPLEX PROTEIN SHAMPOO 11.83 Fl. Oz. True nakhair/nakhairstruturecomplexshampoo11.83.jpg Bonus Deal Available 16.00 16.00 16.00 False False False False 0.00 False False Diversion contract is required NAK Hair STRUCTURE COMPLEX PROTEIN SHAMPOO rescues and repairs damaged hair. True Log in to view pricing! False
    NAK Hair STRUCTURE COMPLEX PROTEIN SHAMPOO 11.83 Fl. Oz.

    NAK Hair
    STRUCTURE COMPLEX PROTEIN SHAMPOO

    Bonus Offer
    View Sizes
  • 171235 YLW-02-RPR16 YLW-02-RPR16 1 Reparative Shampoo 16.9 Fl. Oz. Yellow Professional Yellow Professional REPAIR Reparative Shampoo 16.9 Fl. Oz. True yellowprofessional/yellowreparativeshampoo16.9.jpg Bonus Deal Available 9.98 9.98 7.48 True True Valid Thru 06/30/26 False False 7.48 False False Diversion contract is required Yellow Professional Reparative Shampoo is for damaged hair. True Log in to view pricing! False
    Yellow Professional Reparative Shampoo 16.9 Fl. Oz.

    Yellow Professional
    REPAIR Reparative Shampoo

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 178997 LCO-02-RS8 LCO-02-RS8 1 Rescue Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Lights Co Rescue Shampoo 8.45 Fl. Oz. True alfaparfmilano/alfaparfsemidilinolightscorescueshampoo.jpg Bonus Deal Available 17.00 17.00 17.00 False True Valid Thru 06/30/26 False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Lights Co Rescue Shampoo is a gentle reparative shampoo for damaged hair. True Log in to view pricing! False
    Alfaparf Milano Rescue Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Lights Co Rescue Shampoo

    Bonus Offer
    Promotional ItemLog in to view pricing!
    View Sizes
  • 52860 WEL-02-FP8 WEL-02-FP8 1 Intense Repair Shampoo 8.4 Fl. Oz. Wella Wella Professionals FusionPlex Intense Repair Shampoo 8.4 Fl. Oz. True wella/schwarzkopffusionplexinstenserepairshampoo8oz.jpg Bonus Deal Available 14.60 14.60 11.68 True False False False 11.68 False False Diversion contract is required Wella Professional FusionPlex Intense Repair Shampoo is a delicate shampoo for damaged hair that will help to repair your hair and will leave it clean and cared. True Log in to view pricing! False
    Wella Intense Repair Shampoo 8.4 Fl. Oz.

    Wella
    Professionals FusionPlex Intense Repair Shampoo

    Bonus Offer
    View Sizes
  • 143987 WEL-02-UR8 WEL-02-UR8 1 STEP 1 SHAMPOO 8.4 Fl. Oz. Wella Wella Professionals ULTIMATE REPAIR STEP 1 SHAMPOO 8.4 Fl. Oz. True wella/wellaprofessionalultimaterepairshampoo8oz.jpg Bonus Deal Available 19.30 19.30 15.44 True False False False 15.44 False False Diversion contract is required Wella Professionals ULTIMATE REPAIR STEP 1 SHAMPOO is a rich cream shampoo with a lightweight foaming formula that gently and effectively cleanses hair with a luxurious lather. True Log in to view pricing! False
    Wella STEP 1 SHAMPOO 8.4 Fl. Oz.

    Wella
    Professionals ULTIMATE REPAIR STEP 1 SHAMPOO

    Bonus Offer
    View Sizes
  • 63183 ABA-02-GENT8 ABA-02-GENT8 1 Gentle Shampoo 8 Fl. Oz. ABBA® ABBA® pure gentle Gentle Shampoo 8 Fl. Oz. True abba/abbanewgentleshampoo8oz236ml.jpg Bonus Deal Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required ABBA pure gentle Gentle Shampoo nourishes and calms sensitive skin and scalps utilizing herbal therapy. True Log in to view pricing! False
    ABBA® Gentle Shampoo 8 Fl. Oz.

    ABBA®
    pure gentle Gentle Shampoo

    Bonus Offer
    View Sizes
  • 63191 ABA-02-VOLU8 ABA-02-VOLU8 1 Volume Shampoo 8 Fl. Oz. ABBA® ABBA® pure volume Volume Shampoo 8 Fl. Oz. True abba/abbanewvolumeshampoo8oz236ml.jpg Bonus Deal Available 10.00 10.00 10.00 False False False False 0.00 False False Diversion contract is required ABBA pure volume Volume Shampoo utilizes the power of nature to revive fine, limp hair using powerful botanicals to boost body and volume. True Log in to view pricing! False
    ABBA® Volume Shampoo 8 Fl. Oz.

    ABBA®
    pure volume Volume Shampoo

    Bonus Offer
    View Sizes
  • 137690 LSD-02-DCS16 LSD-02-DCS16 1 Deep Cleansing Shampoo 16.9 Fl. Oz. Alfaparf Milano Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo 16.9 Fl. Oz. False alfaparfmilano/alfaparfmilanoktlddeepcleansingshampoo16oz.jpg Bonus Deal Available 23.63 23.63 23.63 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Lisse Design Keratin Therapy Deep Cleansing Shampoo washes thoroughly and untangles hair perfectly. True Log in to view pricing! False
    Alfaparf Milano Deep Cleansing Shampoo 16.9 Fl. Oz.

    Alfaparf Milano
    Lisse Design Keratin Therapy Deep Cleansing Shampoo

    16.9 Fl. Oz.

    SKU LSD-02-DCS16

    Bonus Offer
    Quick View
  • 143490 SDL-02-RCP8 SDL-02-RCP8 1 Reparative Low Shampoo 8.5 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo 8.5 Fl. Oz. False alfaparfmilano/ma23semidilinoshampoo.jpg Bonus Deal Available 14.70 14.70 14.70 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi di Lino Reconstruction Reparative Low Shampoo, the line that repairs, reconstructs, and strengthens the hair fiber has been renewed and repackaged with 70% recycled plastic. True Log in to view pricing! False
    Alfaparf Milano Reparative Low Shampoo 8.5 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Reconstruction Reparative Low Shampoo

    8.5 Fl. Oz.

    SKU SDL-02-RCP8

    Bonus Offer
    Quick View
  • 65393 SDL-02-RS33 SDL-02-RS33 1 Reparative Low Shampoo Liter Alfaparf Milano Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo Liter False alfaparfmilano/am_sdl-reconstruction-reparative-low-shampoo-liter.jpg Bonus Deal Available 29.40 29.40 29.40 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Reconstruction Reparative Low Shampoo is a gentle restructuring shampoo for damaged hair. True Log in to view pricing! False
    Alfaparf Milano Reparative Low Shampoo Liter

    Alfaparf Milano
    Semi Di Lino Reconstruction Reparative Low Shampoo

    Liter

    SKU SDL-02-RS33

    Bonus Offer
    Quick View
  • 89166 SDL-02-SRES8 SDL-02-SRES8 1 Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. Alfaparf Milano Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz. False alfaparfmilano/alfaparfsdlscalprenewenergyshampoo8.45oz.jpg Bonus Deal Available 14.70 14.70 14.70 False False False False 0.00 False False Diversion contract is required Alfaparf Milano Semi Di Lino Scalp Renew Energizing Low Shampoo gently strengthens, re-densifies and stimulates the hair follicles so that both the scalp and hair fibers can regain balance, strength and body. True Log in to view pricing! False
    Alfaparf Milano Scalp Renew Energizing Low Shampoo 8.45 Fl. Oz.

    Alfaparf Milano
    Semi Di Lino Scalp Renew Energizing Low Shampoo

    8.45 Fl. Oz.

    SKU SDL-02-SRES8

    Bonus Offer
    Quick View
  • 12874 ALX-02-E710 ALX-02-E710 1 E7 Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi E7 Shampoo 10.1 Fl. Oz. True aloxxi/aloxxie7antifrizzshampoo10.1floznew.jpg Bonus Deal Available 15.00 15.00 15.00 False False False False 0.00 False False Diversion contract is required Aloxxi Essential 7 Oil Cleansing Oil Shampoo is an intense hydrating shampoo for dry, coarse, color treated hair. True Log in to view pricing! False
    Aloxxi E7 Shampoo 10.1 Fl. Oz.

    Aloxxi
    E7 Shampoo

    Bonus Offer
    View Sizes
  • 27504 ALX-02-RS300 ALX-02-RS300 1 Reparative Shampoo 10.1 Fl. Oz. Aloxxi Aloxxi Reparative Shampoo 10.1 Fl. Oz. True aloxxi/repair-shampoo-retail.jpg Bonus Deal Available 12.50 12.50 12.50 False False False False 0.00 False False Diversion contract is required Aloxxi's Reparative Shampoo renews damaged hair and restores hydration without stripping strands of nourishment. True Log in to view pricing! False
    Aloxxi Reparative Shampoo 10.1 Fl. Oz.

    Aloxxi
    Reparative Shampoo

    Bonus Offer
    View Sizes
  • 152981 CRR-02-RG8 CRR-02-RG8 1 REGENERATING SHAMPOO 8.4 Fl. Oz. CHRISTOPHE ROBIN CHRISTOPHE ROBIN REGENERATING SHAMPOO 8.4 Fl. Oz. True christopherobin/christopherobinregeneratingshampoo.jpg Bonus Deal Available 20.75 20.75 20.75 False False False False 0.00 False False Diversion contract is required CHRISTOPHE ROBIN REGENERATING SHAMPOO is a creamy shampoo formulated to nourish and revitalize damaged hair. True Log in to view pricing! False
    CHRISTOPHE ROBIN REGENERATING SHAMPOO 8.4 Fl. Oz.

    CHRISTOPHE ROBIN
    REGENERATING SHAMPOO

    Bonus Offer
    View Sizes
  • 109473 DEV-02-CB12 DEV-02-CB12 1 CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. DevaCurl DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz. True devacurl/devagscurlbondcleanser12oz.jpg Bonus Deal Available 14.00 14.00 14.00 False False False False 0.00 False False Diversion contract is required DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser repairs damaged curls. True Log in to view pricing! False
    DevaCurl CURLBOND Re-Coiling Mild Lather Cleanser 12 Fl. Oz.

    DevaCurl
    CURLBOND Re-Coiling Mild Lather Cleanser

    Bonus Offer
    View Sizes
(48 Items)